Results

You can download the results in the following formats: fasta clustal stockholm col
FoldalignM
CPU time: 113.89
Average sequence ID: 0.283922533046
Average free energy: 2.52777777778
Average covariation: 0.453159041394
Average basepair probability: 0.374994866179
Canonical basepairs: NA

Sequence and structure consensus for FoldalignM
VGAYDRGCHYRGYUGUGURCMYAKYGUKSCYAGSKCHYCDGGAYWGSHSSCWYRSAWRAGSAMGYMWCVSDBYGYGKGCWCDDCKKYYYM DGRYMMKRKACAAYSYM
...............................................(.((........))..).......................... .................

The alignment colored using colorrna.pl of the Vienna package

Cluster tree of the methods














Please send any comments or report bugs to Elfar Torarinsson or Stinus Lindgreen
Table