Results

You can download the results in the following formats: fasta clustal stockholm col
FoldalignM
CPU time: 44.61
Average sequence ID: 0.296577946768
Average free energy: -14.9566666667
Average covariation: 0.810416666667
Average basepair probability: 0.61702478934
Canonical basepairs: NA

Sequence and structure consensus for FoldalignM
GRCCMYSUUURKYMYYYKRGGKVWRGKKSYSKRWWACAYKCMSRCUVKGGYKHWGMURRMAKUCMRKGCAWUMMSDGMMYUUKKYCYCGG AWGCYDYSWABCRCYW
(..(..(....((.((((((((((((((((((.(..((((...(((..(.......)...))).))))..)..))))))))))))))))) ).))..)).....)..

The alignment colored using colorrna.pl of the Vienna package

Cluster tree of the methods














Please send any comments or report bugs to Elfar Torarinsson or Stinus Lindgreen
Table